PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G033492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family WRKY
Protein Properties Length: 159aa    MW: 18380.7 Da    PI: 10.1201
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G033492.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.25.2e-3175133159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vk+ +fprsYY+Ct++gC+vkk+++r  +d+ vv++tYeg Hnh+
  HL.SW.v1.0.G033492.1  75 LDDGYRWRKYGQKTVKNGRFPRSYYKCTYQGCNVKKQIQRLCKDEGVVVTTYEGMHNHS 133
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-3260133IPR003657WRKY domain
SuperFamilySSF1182903.14E-2867133IPR003657WRKY domain
PROSITE profilePS5081128.59870135IPR003657WRKY domain
SMARTSM007742.4E-3475134IPR003657WRKY domain
PfamPF031061.1E-2476132IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MENYQLMPSL LSSSDMGSAR LNNKNKVGTE STGTSYDKNL SEKNRKMMKS SPKQGLAEVK  60
RHKFAFQTRS QVDVLDDGYR WRKYGQKTVK NGRFPRSYYK CTYQGCNVKK QIQRLCKDEG  120
VVVTTYEGMH NHSSDDHKYN ENFDHILRRM QTSYANAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-2865132774Probable WRKY transcription factor 4
1wj2_A3e-2865132774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9833340.0HG983334.1 Humulus lupulus mRNA for WRKY transcription factor (Wrky5 gene), cultivar Osvald's 72, clone 4201.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086980.18e-56putative WRKY transcription factor 75
SwissprotQ9FYA24e-44WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0D6DR351e-100A0A0D6DR35_HUMLU; WRKY transcription factor
STRINGVIT_17s0000g01280.t018e-48(Vitis vinifera)
STRINGPOPTR_0001s33560.12e-47(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-45WRKY DNA-binding protein 75